PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim08g041820.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 350aa    MW: 39649.4 Da    PI: 5.2928
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim08g041820.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.87.8e-082983312154
                         HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         k +yp++e++++L +++gL+ +q+ +WF N+R +
  Sopim08g041820.0.1 298 KWPYPTEEDKAKLVEETGLQLKQINNWFINQRKR 331
                         469*****************************87 PP

2ELK285e-10252273122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELKh+L+++Y+++L+++++E++
  Sopim08g041820.0.1 252 ELKHELKQGYKEKLVDIREEIL 273
                         9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.8E-1787131IPR005540KNOX1
PfamPF037902.2E-1689130IPR005540KNOX1
SMARTSM012561.8E-28140195IPR005541KNOX2
PfamPF037916.7E-20145194IPR005541KNOX2
PfamPF037891.8E-6252273IPR005539ELK domain
SMARTSM011889.2E-4252273IPR005539ELK domain
PROSITE profilePS5121310.144252272IPR005539ELK domain
PROSITE profilePS5007111.726272335IPR001356Homeobox domain
SuperFamilySSF466894.06E-16274338IPR009057Homeodomain-like
SMARTSM003892.1E-11274339IPR001356Homeobox domain
CDDcd000862.50E-11275336No hitNo description
Gene3DG3DSA:1.10.10.604.0E-25279336IPR009057Homeodomain-like
PfamPF059207.6E-18292331IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MDMPDQNSPI LMTSLPEQDV KPLEHQQPPP TSLNREILLP QTQYTGESNS NQWLSRSILQ  60
RNIQASNDSD LTKDEFGESE AVNWQNAGYK SEILAHPLFE QLLSAHVACL RIATPVDQLP  120
RIDAQLAQSQ QIVGKYSGLG HGNLSDDKEL DQFLTHYVLL LCSFKEQLQQ HVRVHAMEAV  180
MACWEIEQSL QSLTGVSPGE GTGATMSDDE DEQVDSDANL FEGSLDGHDS MGFGPLIPTE  240
SERSLMERVR QELKHELKQG YKEKLVDIRE EILRKRRAGK LPGDTTSVLK AWWQSHSKWP  300
YPTEEDKAKL VEETGLQLKQ INNWFINQRK RNWHSNPSSS TALKSKRKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A7e-13275339872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1328348RKRNWHSNPSSSTALKSKRKR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0047970.0AB004797.1 Nicotiana tabacum NTH23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244941.10.0PREDICTED: homeobox protein knotted-1-like 3
SwissprotP480001e-177KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLK4CK430.0K4CK43_SOLLC; Uncharacterized protein
STRINGSolyc08g041820.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-179KNOTTED1-like homeobox gene 3